| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | APLF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The APLF Antibody from Novus Biologicals is a rabbit polyclonal antibody to APLF. This antibody reacts with human. The APLF Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human APLF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNVIQGSGKEEICKDKSQLN |
|---|
| Other Names | APFL, aprataxin- and PNK-like factor, aprataxin and PNK-like factor, aprataxin and PNKP like factor, Apurinic-apyrimidinic endonuclease APLF, C2orf13FLJ16593, chromosome 2 open reading frame 13, EC 4.2.99.18, MGC47799, PALF, PNK and APTX-like FHA domain-containing protein, PNK and APTX-like FHA protein, Xip1, XRCC1-interacting protein 1 |
|---|
| Gene, Accession # | APLF, Gene ID: 200558, Accession: Q8IW19, SwissProt: Q8IW19 |
|---|
| Catalog # | NBP2-38212 |
|---|
| Price | |
|---|
| Order / More Info | APLF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|