| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | JAM-A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The JAM-A Antibody from Novus Biologicals is a rabbit polyclonal antibody to JAM-A. This antibody reacts with human. The JAM-A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human JAM-A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTR |
|---|
| Other Names | CD321 antigen, F11 receptor, JAM-1, JAM1CD321, JAMA, JAM-A, JCAMJAM, Junctional adhesion molecule 1Platelet F11 receptor, junctional adhesion molecule A, PAM-1KAT, Platelet adhesion molecule 1 |
|---|
| Gene, Accession # | F11R, Gene ID: 50848, Accession: Q9Y624, SwissProt: Q9Y624 |
|---|
| Catalog # | NBP2-38934 |
|---|
| Price | |
|---|
| Order / More Info | JAM-A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|