| Edit |   |
|---|
| Antigenic Specificity | ISPD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ISPD Antibody from Novus Biologicals is a rabbit polyclonal antibody to ISPD. This antibody reacts with human. The ISPD Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human hCG_1745121. Peptide sequence MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP. |
|---|
| Other Names | 4-diphosphocytidyl-2C-methyl-D-erythritol synthase homolog, isoprenoid synthase domain containing, isoprenoid synthase domain-containing protein |
|---|
| Gene, Accession # | ISPD, Gene ID: 729920, Accession: NP_001094887, SwissProt: NP_001094887 |
|---|
| Catalog # | NBP1-79722-20ul |
|---|
| Price | |
|---|
| Order / More Info | ISPD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|