| Edit |   |
| Antigenic Specificity | ISPD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ISPD Antibody from Novus Biologicals is a rabbit polyclonal antibody to ISPD. This antibody reacts with human. The ISPD Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human hCG_1745121. Peptide sequence MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP. |
| Other Names | 4-diphosphocytidyl-2C-methyl-D-erythritol synthase homolog, isoprenoid synthase domain containing, isoprenoid synthase domain-containing protein |
| Gene, Accession # | ISPD, Gene ID: 729920, Accession: NP_001094887, SwissProt: NP_001094887 |
| Catalog # | NBP1-79722 |
| Price | |
| Order / More Info | ISPD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |