| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TAF1C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TAF1C Antibody from Novus Biologicals is a rabbit polyclonal antibody to TAF1C. This antibody reacts with human. The TAF1C Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TAF1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE |
|---|
| Other Names | MGC:39976, RNA polymerase I-specific TBP-associated factor 110 kDa, SL1, 110kD subunit, SL1TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD, TAFI110TBP-associated factor 1C, TAFI95, TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa, TATA box-binding protein-associated factor 1C, TATA box-binding protein-associated factor RNA polymerase I subunit C, transcription factor SL1, Transcription initiation factor SL1/TIF-IB subunit C |
|---|
| Gene, Accession # | TAF1C, Gene ID: 9013 |
|---|
| Catalog # | NBP2-58841 |
|---|
| Price | |
|---|
| Order / More Info | TAF1C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|