| Edit |   |
|---|
| Antigenic Specificity | INAVA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The INAVA Antibody from Novus Biologicals is a rabbit polyclonal antibody to INAVA. This antibody reacts with human. The INAVA Antibody has been validated for the following applications: Western Blot, Simple Western. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PPQTLEGLQPTGPEAGSPERAPVQNSPWKETSLDHPYEKPRKSSEPWSESSSPATTPQDGPSASSLWLLEPASYHVVPIRG |
|---|
| Other Names | C1orf106, chromosome 1 open reading frame 106, hypothetical protein LOC55765 |
|---|
| Gene, Accession # | C1ORF106, Gene ID: 55765 |
|---|
| Catalog # | NBP1-90424-25ul |
|---|
| Price | |
|---|
| Order / More Info | INAVA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|