Edit |   |
Antigenic Specificity | CDV3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat (antigen sequence identity: mouse 97%, rat 95%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human CDV3 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPS |
Other Names | CDV3 homolog (mouse), H41 |
Gene, Accession # | Gene ID: 55573, UniProt: Q9UKY7, ENSG00000091527 |
Catalog # | HPA029761 |
Price | |
Order / More Info | CDV3 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |