| Edit |   |
|---|
| Antigenic Specificity | ISX |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ISX Antibody from Novus Biologicals is a rabbit polyclonal antibody to ISX. This antibody reacts with human. The ISX Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ISXThe immunogen for this antibody is ISX. Peptide sequence ILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRKSKRRV. |
|---|
| Other Names | intestine-specific homeobox, RAXLX |
|---|
| Gene, Accession # | ISX, Gene ID: 91464, Accession: NP_001008494, SwissProt: NP_001008494 |
|---|
| Catalog # | NBP1-79216-20ul |
|---|
| Price | |
|---|
| Order / More Info | ISX Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|