| Edit |   |
| Antigenic Specificity | ACTR10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACTR10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACTR10. This antibody reacts with human. The ACTR10 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ACTR10(actin-related protein 10 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ACTR10 (NP_060947). Peptide sequence SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL. |
| Other Names | actin-related protein 10 homolog (S. cerevisiae), Actin-related protein 11, ACTR11actin-related protein 10, Arp11, HARP11 |
| Gene, Accession # | ACTR10, Gene ID: 55860, Accession: Q9NZ32, SwissProt: Q9NZ32 |
| Catalog # | NBP1-56886 |
| Price | |
| Order / More Info | ACTR10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |