| Edit |   |
|---|
| Antigenic Specificity | ACTR3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACTR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACTR3. This antibody reacts with human. The ACTR3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to ACTR3(ARP3 actin-related protein 3 homolog (yeast)) Antibody(against the N terminal of ACTR3 (NP_005712). Peptide sequence IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE. |
|---|
| Other Names | actin-related protein 3, ARP3 (actin-related protein 3, yeast) homolog, ARP3 actin-related protein 3 homolog (yeast), ARP3Actin-like protein 3 |
|---|
| Gene, Accession # | ACTR3, Gene ID: 10096, Accession: P61158, SwissProt: P61158 |
|---|
| Catalog # | NBP1-56406 |
|---|
| Price | |
|---|
| Order / More Info | ACTR3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|