| Edit |   |
|---|
| Antigenic Specificity | STUM |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STUM Antibody from Novus Biologicals is a rabbit polyclonal antibody to STUM. This antibody reacts with human. The STUM Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C1ORF95 The peptide sequence was selected from the middle region of C1ORF95. Peptide sequence VFWLNIAAALIQILTAIVMVGWIMSIFWGMDMVILAISQGYKEQGIPQQL. |
|---|
| Other Names | chromosome 1 open reading frame 95, hypothetical protein LOC375057, RP11-9C4.1 |
|---|
| Gene, Accession # | C1ORF95, Gene ID: 375057 |
|---|
| Catalog # | NBP1-70457-20ul |
|---|
| Price | |
|---|
| Order / More Info | STUM Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|