| 产品详情 |
| Edit |   |
| Antigenic Specificity | Beta Ig-h3/TGFBI |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Beta Ig-h3/TGFBI Antibody from Novus Biologicals is a rabbit polyclonal antibody to Beta Ig-h3/TGFBI. This antibody reacts with human. The Beta Ig-h3/TGFBI Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to TGFBI(transforming growth factor, beta-induced, 68kDa) The peptide sequence was selected from the C terminal of TGFBI. Peptide sequence LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA. |
| Other Names | Beta ig-h3, BIGH3EBMD, CDB1, CDG2, CDGG1transforming growth factor, beta-induced, 68kD, CSD, CSD1, CSD2, CSD3, Kerato-epithelin, LCD1, RGD-CAP, RGD-containing collagen-associated protein, transforming growth factor, beta-induced, 68kDa, transforming growth factor-beta-induced protein ig-h3 |
| Gene, Accession # | TGFBI, Gene ID: 7045 |
| Catalog # | NBP1-60049 |
| Price | |
| Order / More Info | Beta Ig-h3/TGFBI Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|