| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CTDSP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CTDSP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTDSP2. This antibody reacts with human. The CTDSP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CTDSP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVID |
|---|
| Other Names | carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2, conserved gene amplified in osteosarcoma, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase 2, NIF2, Nuclear LIM interactor-interacting factor 2, OS4NLI-interacting factor 2, Protein OS-4, PSR2, SCP2EC 3.1.3.16, Small CTD phosphatase 2, Small C-terminal domain phosphatase 2 |
|---|
| Gene, Accession # | CTDSP2, Gene ID: 10106 |
|---|
| Catalog # | NBP2-49053 |
|---|
| Price | |
|---|
| Order / More Info | CTDSP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|