| 产品详情 |
| Edit |   |
| Antigenic Specificity | NHA2/SLC9B2/NHEDC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NHA2/SLC9B2/NHEDC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NHA2/SLC9B2/NHEDC2. This antibody reacts with human. The NHA2/SLC9B2/NHEDC2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NHA2/SLC9B2/NHEDC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPT EANHVQR |
| Other Names | FLJ23984, Mitochondrial Na(+)/H(+) exchanger NHA2, mitochondrial sodium/hydrogen exchanger NHA2, Na(+)/H(+) exchanger-like domain-containing protein 2, Na+/H+ exchanger domain containing 2, NHA2NHE10, NHE domain-containing protein 2, Sodium/hydrogen exchanger-like domain-containing protein 2 |
| Gene, Accession # | SLC9B2, Gene ID: 133308 |
| Catalog # | NBP2-13348 |
| Price | |
| Order / More Info | NHA2/SLC9B2/NHEDC2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|