| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NHA2/SLC9B2/NHEDC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NHA2/SLC9B2/NHEDC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NHA2/SLC9B2/NHEDC2. This antibody reacts with human, mouse. The NHA2/SLC9B2/NHEDC2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NHEDC2(Na+/H+ exchanger domain containing 2) The peptide sequence was selected from the C terminal of NHEDC2. Peptide sequence IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI. |
|---|
| Other Names | FLJ23984, Mitochondrial Na(+)/H(+) exchanger NHA2, mitochondrial sodium/hydrogen exchanger NHA2, Na(+)/H(+) exchanger-like domain-containing protein 2, Na+/H+ exchanger domain containing 2, NHA2NHE10, NHE domain-containing protein 2, Sodium/hydrogen exchanger-like domain-containing protein 2 |
|---|
| Gene, Accession # | SLC9B2, Gene ID: 133308, Accession: Q86UD5, SwissProt: Q86UD5 |
|---|
| Catalog # | NBP1-59579-20ul |
|---|
| Price | |
|---|
| Order / More Info | NHA2/SLC9B2/NHEDC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|