| Edit |   |
|---|
| Antigenic Specificity | DVL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 91%, rat 95%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human DVL2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVP |
|---|
| Other Names | dishevelled segment polarity protein 2 |
|---|
| Gene, Accession # | Gene ID: 1856, UniProt: O14641, ENSG00000004975 |
|---|
| Catalog # | HPA021611 |
|---|
| Price | |
|---|
| Order / More Info | DVL2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|