| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PTBP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTBP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTBP1. This antibody reacts with human. The PTBP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PTBP1(polypyrimidine tract binding protein 1) The peptide sequence was selected from the N terminal of PTBP1. Peptide sequence RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI. |
|---|
| Other Names | Heterogeneous nuclear ribonucleoprotein I, heterogeneous nuclear ribonucleoprotein polypeptide I, hnRNP I, HNRNPI, HNRNP-I, HNRPI, MGC10830, MGC8461, polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoproteinI), polypyrimidine tract binding protein 1, polypyrimidine tract-binding protein 1, pPTB, PTB-1, PTB2, PTB3, PTB4, PTB57 kDa RNA-binding protein PPTB-1, PTB-T, RNA-binding protein |
|---|
| Gene, Accession # | PTBP1, Gene ID: 5725, Accession: P26599, SwissProt: P26599 |
|---|
| Catalog # | NBP1-57123 |
|---|
| Price | |
|---|
| Order / More Info | PTBP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|