| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KCNMB3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KCNMB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCNMB3. This antibody reacts with human. The KCNMB3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KCNMB3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLCIMRRSKGRAEKS |
|---|
| Other Names | BK channel subunit beta-3, BKbeta3, HBETA3, KCNMB2, KCNMBL, potassium large conductance calcium-activated channel, subfamily M beta member3, slo-beta-3, subfamily M subunit beta-3, voltage and Ca2+ activated potassium channel Maxi K beta 3subunit |
|---|
| Gene, Accession # | KCNMB3, Gene ID: 27094 |
|---|
| Catalog # | NBP1-83065 |
|---|
| Price | |
|---|
| Order / More Info | KCNMB3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|