| Edit |   |
| Antigenic Specificity | BCO2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BCO2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCO2. This antibody reacts with mouse. The BCO2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Bco2 - middle region. Peptide sequence CYNIIRVPPKKKEPGETIHGAQVLCSIASTEKMKPSYYHSFGMTKNYIIF. |
| Other Names | beta-carotene oxygenase 2 |
| Gene, Accession # | BCO2, Gene ID: 83875, Accession: NP_573480 |
| Catalog # | NBP1-98381-20ul |
| Price | |
| Order / More Info | BCO2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |