| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LRP-1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRP-1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRP-1B. This antibody reacts with human. The LRP-1B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IANDTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQANSGLICPEF |
|---|
| Other Names | EC 1.1.1.94, EC 3.4.21.9, low density lipoprotein receptor related protein-deleted in tumor, low density lipoprotein receptor-related protein 1B, low density lipoprotein-related protein 1B (deleted in tumors), Low-density lipoprotein receptor-related protein-deleted in tumor, LRP-1B, LRP-deleted in tumors, LRPDIT, LRP-DITlow-density lipoprotein receptor-related protein 1B |
|---|
| Gene, Accession # | LRP1B, Gene ID: 53353 |
|---|
| Catalog # | NBP2-76566 |
|---|
| Price | |
|---|
| Order / More Info | LRP-1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|