| Edit |   |
| Antigenic Specificity | RPL23AP82 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPL23AP82 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL23AP82. This antibody reacts with human. The RPL23AP82 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MGC70863(similar to RPL23AP7 protein) The peptide sequence was selected from the N terminal of MGC70863. Peptide sequence MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE. |
| Other Names | MGC70863, ribosomal protein L23a pseudogene 82, RPL23A_43_1761 |
| Gene, Accession # | RPL23AP82, Gene ID: 284942 |
| Catalog # | NBP1-57370-20ul |
| Price | |
| Order / More Info | RPL23AP82 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |