| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MDL-1/CLEC5A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MDL-1/CLEC5A Antibody from Novus Biologicals is a rabbit polyclonal antibody to MDL-1/CLEC5A. This antibody reacts with human. The MDL-1/CLEC5A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQD |
|---|
| Other Names | CLECSF5carbohydrate-recognition domain) lectin, superfamilymember 5, C-type lectin domain family 5, member A, C-type lectin superfamily member 5, MDL-1MGC138304, Myeloid DAP12-associating lectin 1, myeloid DAP12-associating lectin-1 |
|---|
| Gene, Accession # | CLEC5A, Gene ID: 23601 |
|---|
| Catalog # | NBP2-68708 |
|---|
| Price | |
|---|
| Order / More Info | MDL-1/CLEC5A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|