| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | p18INK4c/CDKN2C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The p18INK4c/CDKN2C Antibody from Novus Biologicals is a rabbit polyclonal antibody to p18INK4c/CDKN2C. This antibody reacts with human. The p18INK4c/CDKN2C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human p18INK4c/CDKN2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG |
|---|
| Other Names | CDK6 inhibitor p18, CDKN6, cyclin-dependent inhibitor, cyclin-dependent kinase 4 inhibitor C, Cyclin-dependent kinase 6 inhibitor, cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4), INK4Ccyclin-dependent kinase 6 inhibitor p18, p18, p18-INK4C, p18-INK6 |
|---|
| Gene, Accession # | CDKN2C, Gene ID: 1031 |
|---|
| Catalog # | NBP1-87687 |
|---|
| Price | |
|---|
| Order / More Info | p18INK4c/CDKN2C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|