| Edit |   |
|---|
| Antigenic Specificity | RG9MTD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RG9MTD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RG9MTD2. This antibody reacts with human. The RG9MTD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human RG9MTD2. Peptide sequence EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA. |
|---|
| Other Names | MGC27034, RNA (guanine-9-) methyltransferase domain containing 2 |
|---|
| Gene, Accession # | TRMT10A, Gene ID: 93587, Accession: NP_689505, SwissProt: NP_689505 |
|---|
| Catalog # | NBP1-80478 |
|---|
| Price | |
|---|
| Order / More Info | RG9MTD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|