| Edit |   |
| Antigenic Specificity | RGP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RGP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RGP1. This antibody reacts with human. The RGP1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is RGP1 - C-terminal region. Peptide sequence FSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLP. |
| Other Names | retrograde Golgi transport protein RGP1 homolog, RGP1 retrograde golgi transport homolog (S. cerevisiae) |
| Gene, Accession # | RGP1, Gene ID: 9827, Accession: NP_001073965, SwissProt: NP_001073965 |
| Catalog # | NBP1-98602-20ul |
| Price | |
| Order / More Info | RGP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |