| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GTSF1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GTSF1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to GTSF1L. This antibody reacts with human. The GTSF1L Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GTSF1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDT |
|---|
| Other Names | C20orf65, chromosome 20 open reading frame 65, dJ1028D15.4, FAM112A, family with sequence similarity 112, member A, gametocyte specific factor 1-like, gametocyte-specific factor 1-like, MGC50820, Protein FAM112A |
|---|
| Gene, Accession # | GTSF1L, Gene ID: 149699, Accession: Q9H1H1, SwissProt: Q9H1H1 |
|---|
| Catalog # | NBP2-38734 |
|---|
| Price | |
|---|
| Order / More Info | GTSF1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|