| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Aprataxin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Aprataxin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aprataxin. This antibody reacts with human. The Aprataxin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Aprataxin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HMVNELYPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSNSGQCSVPLKKGKDAPIKKESLGHWSQGLKISMQDPKMQVYKD |
|---|
| Other Names | AOA1EAOH, AOAMGC1072, aprataxin, ataxia 1, early onset with hypoalbuminemia, AXA1, EC 3.-, EOAHA, FHA-HIT, FLJ20157, Forkhead-associated domain histidine triad-like protein |
|---|
| Gene, Accession # | APTX, Gene ID: 54840, Accession: Q7Z2E3, SwissProt: Q7Z2E3 |
|---|
| Catalog # | NBP2-39041 |
|---|
| Price | |
|---|
| Order / More Info | Aprataxin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|