| Edit |   |
|---|
| Antigenic Specificity | MNS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MNS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MNS1. This antibody reacts with human. The MNS1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MNS1(meiosis-specific nuclear structural 1) The peptide sequence was selected from the middle region of MNS1. Peptide sequence KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL. |
|---|
| Other Names | FLJ11222FLJ26051, meiosis-specific nuclear structural 1, meiosis-specific nuclear structural protein 1 |
|---|
| Gene, Accession # | MNS1, Gene ID: 55329, Accession: Q8NEH6, SwissProt: Q8NEH6 |
|---|
| Catalog # | NBP1-53041-20ul |
|---|
| Price | |
|---|
| Order / More Info | MNS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|