| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Peroxiredoxin 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Peroxiredoxin 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Peroxiredoxin 3. This antibody reacts with human. The Peroxiredoxin 3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Peroxiredoxin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGK |
|---|
| Other Names | Antioxidant protein 1MGC104387, AOP-1MGC24293, AOP1PRO1748, EC 1.11.1.15, HBC189, MER5, peroxiredoxin 3, Peroxiredoxin III, peroxiredoxin-3, Protein MER5 homolog, prx-III, SP-22, thioredoxin-dependent peroxide reductase, mitochondrial |
|---|
| Gene, Accession # | PRDX3, Gene ID: 10935, Accession: P30048, SwissProt: P30048 |
|---|
| Catalog # | NBP2-38486 |
|---|
| Price | |
|---|
| Order / More Info | Peroxiredoxin 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|