| 产品详情 |
| Edit |   |
| Antigenic Specificity | HS3ST5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HS3ST5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HS3ST5. This antibody reacts with human. The HS3ST5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HS3ST5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHEFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHF |
| Other Names | 3-OST-5EC 2.8.2.23, 3OST5NBLA04021, EC 2.8.2, h3-OST-5, heparan sulfate (glucosamine) 3-O-sulfotransferase 5, heparan sulfate 3-OST-5, Heparan sulfate 3-O-sulfotransferase 5, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 5, heparan sulfate glucosamine 3-O-sulfotransferase 5, HS3OST5 |
| Gene, Accession # | HS3ST5, Gene ID: 222537 |
| Catalog # | NBP1-89373 |
| Price | |
| Order / More Info | HS3ST5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|