| Edit |   |
| Antigenic Specificity | HS3ST6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HS3ST6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HS3ST6. This antibody reacts with human. The HS3ST6 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human HS3ST6. Peptide sequence GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP. |
| Other Names | h3-OST-6, heparan sulfate (glucosamine) 3-O-sulfotransferase 6, heparan sulfate 3-O-sulfotransferase 6, heparan sulfate glucosamine 3-O-sulfotransferase 6, HS3ST5 |
| Gene, Accession # | HS3ST6, Gene ID: 64711, Accession: NP_001009606, SwissProt: NP_001009606 |
| Catalog # | NBP1-91324 |
| Price | |
| Order / More Info | HS3ST6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |