| 产品详情 |
| Edit |   |
| Antigenic Specificity | HS3ST3A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HS3ST3A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HS3ST3A1. This antibody reacts with human. The HS3ST3A1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human HS3ST3A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES |
| Other Names | 3-OST-3A, 3OST3A1heparan sulfate glucosamine 3-O-sulfotransferase 3A1,30ST3A1heparin-glucosamine 3-O-sulfotransferase, EC 2.8.2, EC 2.8.2.30, h3-OST-3A, heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1, Heparan sulfate 3-O-sulfotransferase 3A1, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, HS3ST3A |
| Gene, Accession # | HS3ST3A1, Gene ID: 9955 |
| Catalog # | NBP2-56398 |
| Price | |
| Order / More Info | HS3ST3A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|