| Edit |   |
|---|
| Antigenic Specificity | HSU79274 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HSU79274 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSU79274. This antibody reacts with human. The HSU79274 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C12ORF24 The peptide sequence was selected from the N terminal of C12ORF24. Peptide sequence AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ. |
|---|
| Other Names | chromosome 12 open reading frame 24, HSU79274, hypothetical protein LOC29902, protein predicted by clone 23733 |
|---|
| Gene, Accession # | FAM216A, Gene ID: 29902, Accession: Q8WUB2, SwissProt: Q8WUB2 |
|---|
| Catalog # | NBP1-56675 |
|---|
| Price | |
|---|
| Order / More Info | HSU79274 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|