| Edit |   |
|---|
| Antigenic Specificity | C4orf33 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C4orf33 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C4orf33. This antibody reacts with human. The C4orf33 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C4ORF33 The peptide sequence was selected from the C terminal of C4ORF33. Peptide sequence PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF. |
|---|
| Other Names | chromosome 4 open reading frame 33, FLJ33703, hypothetical protein LOC132321 |
|---|
| Gene, Accession # | C4ORF33, Gene ID: 132321, Accession: Q8N1A6, SwissProt: Q8N1A6 |
|---|
| Catalog # | NBP1-57846 |
|---|
| Price | |
|---|
| Order / More Info | C4orf33 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|