| Edit |   |
| Antigenic Specificity | TMCC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMCC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMCC1. This antibody reacts with human. The TMCC1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMCC1(transmembrane and coiled-coil domain family 1) The peptide sequence was selected from the middle region of TMCC1. Peptide sequence YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK. |
| Other Names | DKFZp686M0169, FLJ42680, KIAA0779, transmembrane and coiled-coil domain family 1, transmembrane and coiled-coil domains 1, transmembrane and coiled-coil domains protein 1 |
| Gene, Accession # | TMCC1, Gene ID: 23023, Accession: Q6N039, SwissProt: Q6N039 |
| Catalog # | NBP1-59392 |
| Price | |
| Order / More Info | TMCC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |