| Edit |   |
| Antigenic Specificity | TMCC3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMCC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMCC3. This antibody reacts with human. The TMCC3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human TMCC3. Peptide sequence MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL. |
| Other Names | KIAA1145, transmembrane and coiled-coil domain family 3, transmembrane and coiled-coil domains 3, transmembrane and coiled-coil domains protein 3 |
| Gene, Accession # | TMCC3, Gene ID: 57458, Accession: NP_065749, SwissProt: NP_065749 |
| Catalog # | NBP1-91338 |
| Price | |
| Order / More Info | TMCC3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |