| 产品详情 |
| Edit |   |
| Antigenic Specificity | GRASP55 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GRASP55 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRASP55. This antibody reacts with human, mouse. The GRASP55 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse GRASP55 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV |
| Other Names | Golgi phosphoprotein 6, golgi reassembly stacking protein 2, 55 kDa, golgi reassembly stacking protein 2, 55kDa, Golgi reassembly-stacking protein of 55 kDa, GOLPH6DKFZp434D156, GRASP55FLJ13139, GRS2Golgi reassembly-stacking protein 2, p59 |
| Gene, Accession # | GORASP2, Gene ID: 26003, Accession: Q9H8Y8, SwissProt: Q9H8Y8 |
| Catalog # | NBP1-89747 |
| Price | |
| Order / More Info | GRASP55 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|