| Edit |   |
|---|
| Antigenic Specificity | GRID1 |
|---|
| Clone | 1A9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRID1 Antibody (1A9) from Novus Biologicals is a mouse monoclonal antibody to GRID1. This antibody reacts with human. The GRID1 Antibody (1A9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GRID1 (NP_060021, 349 a.a. - 441 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV |
|---|
| Other Names | glutamate receptor delta-1 subunit, glutamate receptor, ionotropic, delta 1, KIAA1220GluR delta-1 subunit |
|---|
| Gene, Accession # | GRID1, Gene ID: 2894, Accession: NP_060021, SwissProt: NP_060021 |
|---|
| Catalog # | H00002894-M01 |
|---|
| Price | |
|---|
| Order / More Info | GRID1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17438141 |
|---|