| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GRINL1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRINL1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRINL1A. This antibody reacts with human. The GRINL1A Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human GRINL1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAK |
|---|
| Other Names | DKFZp586F1918, glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A, Glutamate receptor-like protein 1A, GRINL1A downstream protein Gdown4, protein GRINL1A, protein GRINL1A, isoforms 4/5 |
|---|
| Gene, Accession # | POLR2M, Gene ID: 81488 |
|---|
| Catalog # | NBP2-57432 |
|---|
| Price | |
|---|
| Order / More Info | GRINL1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|