| 产品详情 |
| Edit |   |
| Antigenic Specificity | SMCHD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SMCHD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMCHD1. This antibody reacts with human. The SMCHD1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SMCHD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED |
| Other Names | DKFZp686O0631, KIAA0650, structural maintenance of chromosomes flexible hinge domain containing 1, structural maintenance of chromosomes flexible hinge domain-containing protein 1 |
| Gene, Accession # | SMCHD1, Gene ID: 23347 |
| Catalog # | NBP1-82978 |
| Price | |
| Order / More Info | SMCHD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23143600 |
| 产品资料 |
|
|