| Edit |   |
| Antigenic Specificity | TRACP/PAP/ACP5 |
| Clone | 2D9 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRACP/PAP/ACP5 Antibody (2D9) from Novus Biologicals is a mouse monoclonal antibody to TRACP/PAP/ACP5. This antibody reacts with human. The TRACP/PAP/ACP5 Antibody (2D9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | ACP5 (AAH25414.1, 72 a.a. - 158 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV |
| Other Names | n/a |
| Gene, Accession # | ACP5, Gene ID: 54, Accession: AAH25414, SwissProt: AAH25414 |
| Catalog # | H00000054-M01 |
| Price | |
| Order / More Info | TRACP/PAP/ACP5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |