| Edit |   |
|---|
| Antigenic Specificity | TRACP/PAP/ACP5 |
|---|
| Clone | 2D9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRACP/PAP/ACP5 Antibody (2D9) from Novus Biologicals is a mouse monoclonal antibody to TRACP/PAP/ACP5. This antibody reacts with human. The TRACP/PAP/ACP5 Antibody (2D9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | ACP5 (AAH25414.1, 72 a.a. - 158 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | ACP5, Gene ID: 54, Accession: AAH25414, SwissProt: AAH25414 |
|---|
| Catalog # | H00000054-M01 |
|---|
| Price | |
|---|
| Order / More Info | TRACP/PAP/ACP5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|