| Edit |   |
| Antigenic Specificity | TRACP/PAP/ACP5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRACP/PAP/ACP5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRACP/PAP/ACP5. This antibody reacts with human. The TRACP/PAP/ACP5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ACP5 (acid phosphatase 5, tartrate resistant) The peptide sequence was selected from the N terminal of ACP5)(50ug). Peptide sequence DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ. |
| Other Names | n/a |
| Gene, Accession # | ACP5, Gene ID: 54, Accession: P13686, SwissProt: P13686 |
| Catalog # | NBP1-57665 |
| Price | |
| Order / More Info | TRACP/PAP/ACP5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |