| Edit |   |
|---|
| Antigenic Specificity | TRACP/PAP/ACP5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRACP/PAP/ACP5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRACP/PAP/ACP5. This antibody reacts with human. The TRACP/PAP/ACP5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ACP5 (acid phosphatase 5, tartrate resistant) The peptide sequence was selected from the N terminal of ACP5)(50ug). Peptide sequence DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ. |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | ACP5, Gene ID: 54, Accession: P13686, SwissProt: P13686 |
|---|
| Catalog # | NBP1-57665-20ul |
|---|
| Price | |
|---|
| Order / More Info | TRACP/PAP/ACP5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|