| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SERPINB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SERPINB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SERPINB1. This antibody reacts with human. The SERPINB1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SERPINB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVN |
|---|
| Other Names | EILEI, ELANH2MNEI, elastase, leukocyte elastase inhibitor, Monocyte/neutrophil elastase inhibitor, Peptidase inhibitor 2, PI-2, PI2M/NEI, protease inhibitor 2 (elastase), monocyte/neutrophil derived, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1, Serpin B1, serpin peptidase inhibitor, clade B (ovalbumin), member 1 |
|---|
| Gene, Accession # | SERPINB1, Gene ID: 1992 |
|---|
| Catalog # | NBP2-49056 |
|---|
| Price | |
|---|
| Order / More Info | SERPINB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|