| 产品详情 |
| Edit |   |
| Antigenic Specificity | WISP-1/CCN4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WISP-1/CCN4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WISP-1/CCN4. This antibody reacts with human. The WISP-1/CCN4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human WISP-1/CCN4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAF |
| Other Names | CCN family member 4, CCN4WISP1tc, WISP-1, WISP1c, WISP1i, WNT1 induced secreted protein 1, Wnt-1 inducible signaling pathway protein 1, WNT1 inducible signaling pathway protein 1, wnt-1 signaling pathway protein 1, Wnt-1-induced secreted protein, WNT1-inducible-signaling pathway protein 1 |
| Gene, Accession # | WISP1, Gene ID: 8840 |
| Catalog # | NBP1-86570 |
| Price | |
| Order / More Info | WISP-1/CCN4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|