| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIP5K2 alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIP5K2 alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIP5K2 alpha. This antibody reacts with human. The PIP5K2 alpha Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PIP5K2 alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE |
|---|
| Other Names | 1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-4-phosphate-5-kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide kinase 2-alpha, EC 2.7.1, EC 2.7.1.149, FLJ13267, phosphatidylinositol-4-phosphate 5-kinase, type II, alpha, Phosphatidylinositol-5-phosphate 4-kinase type II alpha, phosphatidylinositol-5-phosphate 4-kinase type-2 alpha, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha, PI(5)P 4-kinase type II alpha, PIP4KII-alpha, PIP5K2, PIP5K2API5P4KA, PIP5KIIA, PIP5KIIalpha, PIP5KII-alpha, PIP5KIII, PIPK, PtdIns(4)P-5-kinase B isoform, PtdIns(4)P-5-kinase C isoform, PtdIns(5)P-4-kinase isoform 2-alpha, type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform |
|---|
| Gene, Accession # | PIP4K2A, Gene ID: 5305 |
|---|
| Catalog # | NBP2-56952 |
|---|
| Price | |
|---|
| Order / More Info | PIP5K2 alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|