| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIP5K2 alpha |
|---|
| Clone | 3A3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIP5K2 alpha Antibody (3A3) from Novus Biologicals is a mouse monoclonal antibody to PIP5K2 alpha. This antibody reacts with human. The PIP5K2 alpha Antibody (3A3) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PIP5K2A (NP_005019 304 a.a. - 365 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD |
|---|
| Other Names | 1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-4-phosphate-5-kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide kinase 2-alpha, EC 2.7.1, EC 2.7.1.149, FLJ13267, phosphatidylinositol-4-phosphate 5-kinase, type II, alpha, Phosphatidylinositol-5-phosphate 4-kinase type II alpha, phosphatidylinositol-5-phosphate 4-kinase type-2 alpha, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha, PI(5)P 4-kinase type II alpha, PIP4KII-alpha, PIP5K2, PIP5K2API5P4KA, PIP5KIIA, PIP5KIIalpha, PIP5KII-alpha, PIP5KIII, PIPK, PtdIns(4)P-5-kinase B isoform, PtdIns(4)P-5-kinase C isoform, PtdIns(5)P-4-kinase isoform 2-alpha, type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform |
|---|
| Gene, Accession # | PIP4K2A, Gene ID: 5305, Accession: NP_005019, SwissProt: NP_005019 |
|---|
| Catalog # | H00005305-M01 |
|---|
| Price | |
|---|
| Order / More Info | PIP5K2 alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|