| 产品详情 |
| Edit |   |
| Antigenic Specificity | ID2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB and IHC reported in the literature (PMID: 23063798) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ID2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ID2. This antibody reacts with human, mouse. The ID2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG |
| Other Names | BHLHB26, bHLHb26cell growth-inhibiting gene 8, Class B basic helix-loop-helix protein 26, DNA-binding protein inhibitor ID2, DNA-binding protein inhibitor ID-2, GIG8, helix-loop-helix protein ID2, ID2A, ID2H, inhibitor of differentiation 2, Inhibitor of DNA binding 2, inhibitor of DNA binding 2, dominant negative helix-loop-helix protein, MGC26389 |
| Gene, Accession # | ID2, Gene ID: 3398 |
| Catalog # | NBP1-88630 |
| Price | |
| Order / More Info | ID2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23063798, 24293546 |
| 产品资料 |
|
|