| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ID3 |
|---|
| Clone | 4G1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ID3 Antibody (4G1) from Novus Biologicals is a mouse monoclonal antibody to ID3. This antibody reacts with human. The ID3 Antibody (4G1) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
|---|
| Immunogen | ID3 (NP_002158, 1 a.a. - 83 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV |
|---|
| Other Names | BHLHB25, bHLHb251R21, Class B basic helix-loop-helix protein 25, DNA-binding protein inhibitor ID-3, HEIR1, HEIR-1, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21, Inhibitor of DNA binding 3, inhibitor of DNA binding 3, dominant negative helix-loop-helix protein |
|---|
| Gene, Accession # | ID3, Gene ID: 3399, Accession: Q02535, SwissProt: Q02535 |
|---|
| Catalog # | H00003399-M01 |
|---|
| Price | |
|---|
| Order / More Info | ID3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|