| Edit |   |
| Antigenic Specificity | ZFYVE21 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZFYVE21 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZFYVE21. This antibody reacts with human. The ZFYVE21 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is ZFYVE21 - middle region. Peptide sequence CALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRLSNNQRYLF. |
| Other Names | FYVE domain containing 21, ZF21MGC2550, zinc finger FYVE domain-containing protein 21, zinc finger, FYVE domain containing 21 |
| Gene, Accession # | ZFYVE21, Gene ID: 79038, Accession: NP_076976, SwissProt: NP_076976 |
| Catalog # | NBP1-98434 |
| Price | |
| Order / More Info | ZFYVE21 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |